Posts

Showing posts from April, 2013

ujian KIPA

Image
Huhai tak terkata rasanya sebaik terima soalan KIPA masa tu.. Rasa mcm tgh seat soalan PTD pon ada jugak. Punye semangat menulis nota dgn Hint2 yg dpt.. sekali yg keluar byk soalan am..

Mcm ni kot mukenye tgk soalan no.1 dia ty psl surat rasmi,  tgk page ke2, dia ty pasal penyusunan fail.. Sabar je la.. xde pon blajar dlm kelas.. ok be positive.. pengetahuan am tu..
Soalan objektif 50 soalan.. nak tulis nama pon kena pki objektif jugak.. Bayangkan insan yang diberi nama sampai 3 suku kata tu.. heheh x best sebenarnye soalan objektif ni.. jwpn nye 4 tu jela, klu x A, B, C mesti D
Cuba la soalan esei mcm induksi tu,  mesti macam gambar kt ats ni la jadinye. sng sikit nak menggoreng sampai hangus
tapi hakikatnye? objektif la objektif.. tadaaa dan antara byk2 soalan dalam tu, ada 4 soalan berturut psl multiple intelligence atau kecerdasan pelbagai, yg tu je jwb paling yakin betol.. 
soalan yg lain kita baling dadu.. heheh




koleksi madah di tanah tinggi

Image
2 minggu berada di tanah tinggi ni, memang rasa tenang dari segala kerja kat opis tu. Sebulan rasanya tiada sabtu ahad duduk di rumah, setiap minggu kena kerja. Nak gi kursus ni pon aritu, terpkasa siapkan transkrip untuk pelajar konvokesyen.

Memang tak dinafikan, rasa sejuk kat sini ada rasa luar dari biasa. Tapi pergerakan kat sini pon luar biasa malasnya.. haish apa nak jadi ni. Kalau nak cerita yang x best? BANYAK ok.. malas nak citer panjang. 
Berita tak bestnye, Preve pancit kat Pasir Gudang, die rindu kan kat tuan die yg comel ni.. hehe.. Kunci kete tinggal kat housemate tersayang tapi steering lock bole lupa bagi.. aduhai akashah, kenapa la bole lupa.  Banyak makan semut.
Hmm, setelah sekian lama ilham berpuisi menghilang, di sini lah bermacam kata tercipta.. Ala-ala lagu FAizal Tahir tu " Memori Tercipta". Macam kat bawah ni. 

Kalau tanam kacang xkan nak dapat gula2.. Bila daki tangga ke atas takkan boleh jumpa keli di air. (11 April 2013)
Cuma darjat kesabaran yg ting…

Jom study 5 : kerangka Pengurusan PdP

Charlotte Danielson (2011)  Apakah 4 domain dalam KErangka Charlotte? Perancangan & Penyediaan Penguasaan isi kandungan & pedagogi pengetahuan mengenai murid Tetapkan hasilan pengajaran pengetahuan ttg sumber (bhn mengajar) mereka bentuk pentaksiran murid (Sesuaikan dgn situasi sebenar) Persekitaran bilik darjah Bentuk persekitran saling menghormati dan bekerjasama bentuk budaya pembelajaran prosedur2 bilik darjah mengurus pelakuan murid mengurus persekitaran fizikal Pengajaran berkomunikasi dgn murid teknik soal dan bincang libatkan murid dlm pmbelajaran pentaksiran dlm pgjaran menunjukkan fleksibiliti dan sifat responsive T/jawab Professional imbas semula pgjaran kendali rekod dgn tepat berkomunikasi dgn kluarga pglibatan komuniti professional perkembgn professionalisme pemaparan professionalisme 

Jom Study 4-kajian tindakan

1. Siapakah bapa kajian tindakan
    KURT LEWIN

2. 4 Elemen kajian tindakan (PAOR) -OLEH Kemmis 92')
    merancang (plan)    Bertindak (act)    Memerhati (observe)    Mereflek (reflect) 3. 4 cara kumpul data/alat kajian
soal selidik (terbuka @ tertutup )pemerhatian (berstruktur @ tdk berstruktur)temubual (face-to-face/telefon)analisis dokumen (manual @ spss) 4. Pendekatan / metologi ada 2:
Kualitatifbersifat subjektifpercakapanpemerhatianpenyemakan perk yg dkajiKuantitatif bersifat numerical dan libtkan statistic trhdp datasampel besar/populasimklumat melalui fakta dan bukti statisticpenganalisaan statistic melalui spss5.Prinsip Pengumpulan data
Mudah diperolehiKesahihan datacukup utk rumusanrelevan utk kajianboleh pindah balik 6. Panduan menjayakan temubual
Gunakan soalan probing spt apa pndgn tuan...?ulangi soalan jk perluberi masa cukup utk responden jwbtiada paksaan atau ugutanberhenti jika ada riak keletihan dr responden  7. Refleksi Program intervensi terdiri dpd:
nama programtari…

jom study3: Falsafah Pend. Kebangsaan

Image
nama pon slot falsafah, normalnya ngantuk abes bila masuk slot ni.. terima je la apa yg masuk time tu, yg pastinya notes ni kasha x conteng notes sgt ms dlm kelas.. hmm watpe ntah time tu.. haish.. dok nengok video je lebih kan.. hoho falsafah pendidikan kebangsaan ni, masa nak interview jd pensyarah dulu, bukan main hafal lagi, gile panjang mcm ni.. heheh seb bek kali ni xyah hafal sgt kot sbb soalan objektif..faham sudah.. Konsep @ hasratnya, : lahirkan modal insan seimbang dr segi JERI ( Jasmani emosi rohani intelek) bersandarkan kpercayaan & kepatuhan kpd Tuhan. pendidikan bersepadu dr segi BIN ( Bahasa, Ilmu&kemahiran, Nilai murni Perlaksanaan melalui: kurikulum & sukatan pelajaran pdp Hasilnya:IP4BS insan yg baik percaya & patuh Tuhan berilmu , berpengetahuan & brketerampilan bertanggungjawab Berakhlak Mulia Berbakti, menyumbang kpd Negara sahsiah sepadu &seimbang _________________________________________________________________________________ SIstem Pendidikan …

Jom Study 2: slot Dr James

Image
Loceng .. loceng.. heheh mana bole lupa setiap aktiviti mesti Dr James akan guna loceng untuk control kelas kan? rasa cam jual ais krim pon ada.. anyway kelas ni banyak mendedahkan pasal teknik pembelajaran baru dalam kelas. Bukan chalk and talk aje. Yelah, masa kita study dulu pon bosan dgr Marker pen & talk tu heheh..

ada 3 perk. penting dlm slot ni:
konsep pemb. berkesanteori utamamodul pengajarn pdp
1. Apa yang diperkenalkan  oleh COOPER dlm pengajaran berkesan?
    Menurut Cooper, guru berkesan ialah guru yg mampu menghasilkan pembelajaran yg dihasratkan.
(maknanya hasl pembelajaran lah jd kayu pengukur s/ada guru tu ajr berkesan ke x)

2. Ciri guru yang baik?
   - tidak jahat    -suke menolong    -pengasih
   - beri faedah   - menepati masa   - teliti

3. Ciri guru berkesan?
  - mampu hslkan kptusan dikhendaki
  - cekap, berhasil, menguasai ilmu, dinamik
  - produktif, kompeten, pakar

4. Teori utama:

Behaviorisme (pengubahan tingkah laku)
teacher-centered , berpusatkan guruGuru:A…

Jom study KIPA

Tipsnya: Jumlah Jam pengajaran dalam KIPA mempengaruhi jumlah soalan dalam objektif yang mengandungi 50 soalan tu.. contohnya kalau 2 jam ada 2 soalan. 4jam ada 4 soalan.

sosiologi pendidikan

 1. Socius (kawan) + Logos (Pengetahuan) = Sosiologi

2. Siapa bapa sosiologi?
    auguste comte

3. Apakah maksud mobility social?
    Pergerakan individu atau kumpulan dari satu kedudukan social kepada satu kedudukan social yang lain

4. Jenis mobiliti:
menegak: atas ke bwh sesuatu hierarki dalam organisasimendatar: pergerakan indivu/kump dr satu kawasan ke kawasan yg lain Intergenerational: Perubahan individu berfungsi dari anak kepada bapa atau dari fungsi putera kpd rajaIntragenerational: perubahan kedudukan seperti putera raja ditabalkan menjaadi sultan,Social climbing: perubahan dari gagal->lemah->lulus->cemerlang atau miskin tegar- miskin- sederhana-beradaSocial sinking: bertentangan dgn climbing (menurun)
5. Faktor mempengaruhi perubahan  social
kuasapentadbiranekonomikepercayaan/pen…

Teater Muzikal Kg Baru @PIS

Image
Mencipta satu inovasi dalam PdPPASIR GUDANG, 3 April: Siapa sangka pelajar Diploma Pengurusan Pelancongan Politeknik Ibrahim Sultan (PIS) sangat berbakat dalam persembahan 'Teater Muzikal Kg. Baru'. Seramai 77 orang pelajar semester 6    dan kumpulan Tari Ujong Tanah PIS terlibat dalam persembahan julung kali diadakan di Politeknik Premier ini. 
Persembahan ini sebenarnya merupakan satu pembaharuan bagi subjek HT619 - Visitor Interpretation Services sebagai satu projek dalam penilaian subjek tersebut. Seramai 7 orang pensyarah terlibat dalam menjayakan persembahan ini dan dengan penasihat bersama 3 orang alumni Sekolah Seni Johor Bahru. 
Ketua Jabatan Pelancongan & Hospitaliti, Tn. Syed Sheikh Bin Syed A.Kadir, berpendapat ini merupakan usaha yang baik dalam pembelajaran dimana ia dapat melihat keyakinan pelajar dalam menjayakan sesuatu event. 
Pensyarah dari INSTEDT yang turut bersama menyaksikan persembahan teater ini, Cik Faridah Ahmad menyatakan bahawa ia merupakan per…